Transporter Protein
YPO3832


    Transport Function
Transporter Name: YPO3832
Transporter Type: Secondary Transporter
Transporter Family: RhtB (TC#: 2.A.76)
The Resistance to Homoserine/Threonine (RhtB) Family
Transporter Subfamily: 
Substrate/Function: threonine efflux
TC#: 
^ Return to the top ^

    Genome Locus
PID:   16123967     Blast
Source:   Yersinia pestis CO-92
Chromosome:   CHR
Location:   4299867..4300487
Gene:   rhtC
Length:  206
Strand:  -
Code:   E (Amino acid transport and metabolism)
COG:   COG1280
Product:  threonine efflux protein
^ Return to the top ^

    Transmembrane Segment
TMSs: 
TMHMM Server 
Total:     6
TMS 1:  4-26
TMS 2:  42-64
TMS 3:  68-90
TMS 4:  119-141
TMS 5:  151-173
TMS 6:  186-205
Topology:   >YPO3832
MLMLFLTVAFIHLVALISPGPDFFFVSQTAASRSRGEAMMGVLGISLGIVIWAGVALMGLNLILQKMAWL
HQIIMVGGGMYLCWMGWQLLKSARAKHDVAEEEVQVVLPARGRTFIRGLLTNLSNPKAVIYFGSVFSWFV
GDDVGAGARWGLFILIVGETFLWFTVVACVFALPTMRRGYQRLSKWIDGLAGVLFAGFGIQLILSR
^ Return to the top ^

    Sequence
Protein Sequence: >YPO3832 16123967 threonine efflux protein [Yersinia pestis CO-92]
MLMLFLTVAFIHLVALISPGPDFFFVSQTAASRSRGEAMMGVLGISLGIVIWAGVALMGLNLILQKMAWL
HQIIMVGGGMYLCWMGWQLLKSARAKHDVAEEEVQVVLPARGRTFIRGLLTNLSNPKAVIYFGSVFSWFV
GDDVGAGARWGLFILIVGETFLWFTVVACVFALPTMRRGYQRLSKWIDGLAGVLFAGFGIQLILSR
DNA Sequence: >YPO3832 16123967 threonine efflux protein [Yersinia pestis CO-92]
ATGTTGATGCTATTTCTCACCGTTGCGTTTATTCATCTGGTTGCTCTGATTAGTCCAGGGCCTGACTTCT
TTTTTGTATCGCAAACTGCCGCCAGCCGCTCACGTGGTGAGGCGATGATGGGCGTGCTGGGGATCTCGCT
AGGAATTGTTATTTGGGCTGGGGTAGCACTGATGGGGTTGAATCTCATCTTGCAGAAAATGGCTTGGCTG
CATCAAATTATTATGGTCGGCGGTGGGATGTATCTGTGTTGGATGGGGTGGCAGCTATTGAAATCGGCCC
GTGCTAAACATGATGTCGCCGAAGAAGAGGTACAGGTCGTCTTGCCTGCCCGTGGCCGCACGTTTATCCG
TGGTCTGCTGACCAACCTGTCGAACCCAAAAGCCGTTATCTATTTCGGTAGTGTATTCTCATGGTTTGTC
GGTGATGACGTGGGTGCAGGTGCGCGCTGGGGGTTGTTTATCCTGATTGTTGGCGAAACCTTCTTATGGT
TCACCGTGGTGGCCTGCGTATTTGCGTTACCCACCATGCGCCGTGGTTATCAGCGGCTTTCCAAGTGGAT
TGATGGGCTGGCAGGTGTGTTATTTGCCGGTTTTGGTATCCAACTGATATTGTCCCGCTAA
^ Return to the top ^

    Publications
Publications on this gene:
1.  BMC Microbiol 2003 Jun 30; (3):13.
Annotation and evolutionary relationships of a small regulatory RNA gene micF and its target ompF in Yersinia species.

Delihas N ,

Department of Molecular Genetics and Microbiology, School of Medicine, SUNY Stony Brook, NY 11794-5222, USA. nicholas.delihas@stonybrook.edu

BACKGROUND: micF RNA, a small regulatory RNA found in bacteria, post-transcriptionally regulates expression of outer membrane protein F (OmpF) by interaction with the ompF mRNA 5'UTR. Phylogenetic data can be useful for RNA/RNA duplex structure analyses and aid in elucidation of mechanism of regulation. However micF and associated genes, ompF and ompC are difficult to annotate because of either similarities or divergences in nucleotide sequence. We report by using sequences that represent "gene signatures" as probes, e.g., mRNA 5'UTR sequences, closely related genes can be accurately located in genomic sequences. RESULTS: Alignment and search methods using NCBI BLAST programs have been used to identify micF, ompF and ompC in Yersinia pestis and Yersinia enterocolitica. By alignment with DNA sequences from other bacterial species, 5' start sites of genes and upstream transcriptional regulatory sites in promoter regions were predicted. Annotated genes from Yersinia species provide phylogenetic information on the micF regulatory system. High sequence conservation in binding sites of transcriptional regulatory factors are found in the promoter region upstream of micF and conservation in blocks of sequences as well as marked sequence variation is seen in segments of the micF RNA gene. Unexpected large differences in rates of evolution were found between the interacting RNA transcripts, micF RNA and the 5' UTR of the ompF mRNA. micF RNA/ompF mRNA 5' UTR duplex structures were modeled by the mfold program. Functional domains such as RNA/RNA interacting sites appear to display a minimum of evolutionary drift in sequence with the exception of a significant change in Y. enterocolitica micF RNA. CONCLUSIONS: Newly annotated Yersinia micF and ompF genes and the resultant RNA/RNA duplex structures add strong phylogenetic support for a generalized duplex model. The alignment and search approach using 5' UTR signatures may be a model to help define other genes and their start sites when annotated genes are available in well-defined reference organisms.

Publication Type: Research Support, Non-U.S. Gov't;

^ Return to the top ^

    External Links

   TIGR CMRTHE SEEDThe SEED  
^ Return to the top ^

    NBCI Gene Page
^ Return to the top ^